DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amx and TM2D1

DIOPT Version :9

Sequence 1:NP_001245591.1 Gene:amx / 43869 FlyBaseID:FBgn0000077 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_114416.1 Gene:TM2D1 / 83941 HGNCID:24142 Length:207 Species:Homo sapiens


Alignment Length:151 Identity:53/151 - (35%)
Similarity:72/151 - (47%) Gaps:30/151 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GERSFQRQMNCRYCYQTEMWQQSCGQRSSCNSATDKLFR-TNCTVHHDVLCL-----------GN 206
            ||.|.:       |...::.|..| :....|.||.:... ||.|.|  |.|.           ||
Human    42 GEESLK-------CEDLKVGQYIC-KDPKINDATQEPVNCTNYTAH--VSCFPAPNITCKDSSGN 96

  Fly   207 RS-FTRN-------LRCNWTQGYRWSTALLISLTLGGFGADRFYLGHWQEGIGKLFSFGGLGVWT 263
            .: ||.|       :.|....||.:..|:.:||.||..||||||||:...|:.|..:.|..|:.:
Human    97 ETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGS 161

  Fly   264 IIDVLLISMHYLGPADGSLYI 284
            :||.:||||..:||:|||.||
Human   162 LIDFILISMQIVGPSDGSSYI 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amxNP_001245591.1 TM2 219..268 CDD:282945 21/48 (44%)
TM2D1NP_114416.1 TM2 117..166 CDD:310034 21/48 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5008
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.