DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amx and C02F5.13

DIOPT Version :9

Sequence 1:NP_001245591.1 Gene:amx / 43869 FlyBaseID:FBgn0000077 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001021138.1 Gene:C02F5.13 / 3565859 WormBaseID:WBGene00015353 Length:210 Species:Caenorhabditis elegans


Alignment Length:212 Identity:61/212 - (28%)
Similarity:85/212 - (40%) Gaps:55/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SNGNNNMLCPY-----DKETPC-------DRLQF---------PCIRCNYNHGCIYGRDLNVTCE 145
            |||||.....:     :|...|       |.|..         |.:.|.:.....      :.||
 Worm    16 SNGNNEFRIEFEYPNNEKSEKCFDSSKENDLLDLFYVSTNPLGPVVECRFLENSF------ILCE 74

  Fly   146 VINNVQCLG---------ERSFQRQMNCRYCYQTEMWQQSCGQRSSCNSATDKLFRTN--CTVHH 199
              :.|...|         ..||:.:..|         .:..|.|     |.|..| ||  |.|..
 Worm    75 --DPVPLYGPGQTGQQPANESFRNEGKC---------LKMGGYR-----AEDVEF-TNVKCRVLP 122

  Fly   200 DVLCLGNRSFTRNLRCNWTQGYRWSTALLISLTLGGFGADRFYLGHWQEGIGKLFSFGGLGVWTI 264
            .:.|.|.|:||::..|....|:.:.|.||.|:.||....|||.||:....:|||.:.||.|:|.|
 Worm   123 CIECHGPRTFTKSTPCIIYNGHYFLTTLLYSIFLGVVAVDRFCLGYSAMAVGKLMTLGGFGIWWI 187

  Fly   265 IDVLLISMHYLGPADGS 281
            :|:.|:.:..|||||.|
 Worm   188 VDIFLLVLGVLGPADDS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amxNP_001245591.1 TM2 219..268 CDD:282945 21/48 (44%)
C02F5.13NP_001021138.1 TM2 142..191 CDD:282945 21/48 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.