DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amx and CG11103

DIOPT Version :9

Sequence 1:NP_001245591.1 Gene:amx / 43869 FlyBaseID:FBgn0000077 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001033842.2 Gene:CG11103 / 32342 FlyBaseID:FBgn0030522 Length:224 Species:Drosophila melanogaster


Alignment Length:231 Identity:68/231 - (29%)
Similarity:98/231 - (42%) Gaps:72/231 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VSSMV---AKSGGGAGGLLDNITAYSSSSSSSSSNG---------NNNMLCPY------DKETPC 118
            |.|:|   |:.|.|.|      .:.||||:||:|.|         ..|::|.:      |.:.|.
  Fly    39 VQSVVPVQAQLGSGMG------PSSSSSSASSASGGAGNSAFYPLGPNVMCSFLPRDFLDCKDPV 97

  Fly   119 DRLQFPCIRCNYNHGCI-YGRDLNVTCEVINNVQCLGERSFQRQMNCRYCYQTEMWQQSCGQRSS 182
            |..:....:....:||: :|   ..|.|.:.:..                    :|         
  Fly    98 DHRENATAQQEKKYGCLKFG---GSTYEEVEHAM--------------------VW--------- 130

  Fly   183 CNSATDKLFRTNCTVHHDVLCLGNRSFTR-NLRC-NWTQGYRWSTALLISLTLGGFGADRFYLGH 245
                        |||..|:.|.|||:|.| .:.| .:|..| :.|.|:.|:.||..|.|||.||.
  Fly   131 ------------CTVFADIECYGNRTFLRAGVPCVRYTDHY-FVTTLIYSMLLGFLGMDRFCLGQ 182

  Fly   246 WQEGIGKLFSFGGLGVWTIIDVLLISMHYLGPADGS 281
            ....:|||.:.||:|||.||||:|:..:.|.|.|||
  Fly   183 TGTAVGKLLTMGGVGVWWIIDVILLITNNLLPEDGS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amxNP_001245591.1 TM2 219..268 CDD:282945 23/48 (48%)
CG11103NP_001033842.2 TM2 156..205 CDD:377473 24/49 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21016
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.