DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amx and Tm2d3

DIOPT Version :9

Sequence 1:NP_001245591.1 Gene:amx / 43869 FlyBaseID:FBgn0000077 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001099737.1 Gene:Tm2d3 / 292995 RGDID:1564929 Length:261 Species:Rattus norvegicus


Alignment Length:185 Identity:93/185 - (50%)
Similarity:119/185 - (64%) Gaps:11/185 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PYDKETP----CDRLQFPCIRCNYNHGCIYGRDLNVTCEVINNVQCLG-----ERSFQRQMNCRY 166
            ||..:.|    |.||...||.|..|..|.||:.:...|.|..:|.|:.     :|:|...|.||:
  Rat    77 PYMMKCPSNGLCSRLPADCIECATNASCTYGKPVTFDCTVKPSVTCVDQDLRPQRNFVINMTCRF 141

  Fly   167 CYQTEMWQQSCGQRSSCNSAT--DKLFRTNCTVHHDVLCLGNRSFTRNLRCNWTQGYRWSTALLI 229
            |:|.......|...::|.:..  .:.:..||||...:.|||||:|.:.|.||||.||:|||||.:
  Rat   142 CWQLPETDYECSNSTTCMTVACPRQRYFANCTVRDHIHCLGNRTFPKLLYCNWTGGYKWSTALAL 206

  Fly   230 SLTLGGFGADRFYLGHWQEGIGKLFSFGGLGVWTIIDVLLISMHYLGPADGSLYI 284
            |:|||||||||||||.|:||:||||||||||:||:||||||.:.|:|||||||||
  Rat   207 SITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amxNP_001245591.1 TM2 219..268 CDD:282945 38/48 (79%)
Tm2d3NP_001099737.1 TM2 196..245 CDD:377473 38/48 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12275
Inparanoid 1 1.050 109 1.000 Inparanoid score I4805
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385397at2759
OrthoFinder 1 1.000 - - FOG0005547
OrthoInspector 1 1.000 - - oto97385
orthoMCL 1 0.900 - - OOG6_106920
Panther 1 1.100 - - LDO PTHR21016
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3965
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.