DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amx and Tm2d2

DIOPT Version :9

Sequence 1:NP_001245591.1 Gene:amx / 43869 FlyBaseID:FBgn0000077 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001017444.1 Gene:Tm2d2 / 290833 RGDID:1306769 Length:213 Species:Rattus norvegicus


Alignment Length:283 Identity:61/283 - (21%)
Similarity:98/283 - (34%) Gaps:105/283 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RSAIVLIMIFVLTGIRNSETASGGNQMDLSDSKGDHKDNSNASNGNGNANDNEVYVPPLVSSMVA 77
            ::|::|..:.:|..:..|.:.:...::||:.|...|.:...||:..                   
  Rat    16 QAALLLGNLLLLHCVSRSHSFNATAELDLTPSGAAHLEGPAASSWE------------------- 61

  Fly    78 KSGGGAGGLLDNITAYSSSSSSSSSNGNNNMLCPY------DKETPCDRLQFPCIRCNYNHGCI- 135
                           ||..:|..       :||.|      |.:.|.|.:..........:||: 
  Rat    62 ---------------YSDPNSPV-------ILCSYLPDEFVDCDAPVDHVGNATAYQELGYGCLK 104

  Fly   136 YG----RDLN---VTCEVINNVQCLGERSFQRQMNCRYCYQTEMWQQSCGQRSSCNSATDKLFRT 193
            :|    .|:.   |.|..:..::|...|:|.|                                 
  Rat   105 FGGQAYSDVEHTAVQCRALEGIECASPRTFLR--------------------------------- 136

  Fly   194 NCTVHHDVLCLGNRSFTRNLRCNWTQGYRWSTALLISLTLGGFGADRFYLGHWQEGIGKLFSFGG 258
                             :|..|....|:.:.|.||.|..||.||.|||.|||....:|||.:.||
  Rat   137 -----------------KNKPCIKYTGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGG 184

  Fly   259 LGVWTIIDVLLISMHYLGPADGS 281
            ||:|..:|::|:....|.|:|||
  Rat   185 LGIWWFVDLILLITGGLMPSDGS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amxNP_001245591.1 TM2 219..268 CDD:282945 24/48 (50%)
Tm2d2NP_001017444.1 TM2 145..194 CDD:377473 24/48 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.