DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amx and C41D11.9

DIOPT Version :9

Sequence 1:NP_001245591.1 Gene:amx / 43869 FlyBaseID:FBgn0000077 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_491372.1 Gene:C41D11.9 / 266651 WormBaseID:WBGene00016567 Length:195 Species:Caenorhabditis elegans


Alignment Length:168 Identity:69/168 - (41%)
Similarity:102/168 - (60%) Gaps:19/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 IRCNYNHGCIYGRDLNVTCE---------VINNVQCLGERSFQRQMNCRYCYQTEMWQQSCGQRS 181
            :.|.:...|..|..:.|.|.         ..|||:.:          ||:|:|.......|...:
 Worm    38 LTCTFPGDCRIGDTVKVNCTSRKGCPNPVSRNNVEAV----------CRFCWQLLPGDYDCEPAT 92

  Fly   182 SCNSATDKLFRTNCTVHHDVLCLGNRSFTRNLRCNWTQGYRWSTALLISLTLGGFGADRFYLGHW 246
            :|::::.||..|.|:.|..|:|:|.|:|.:.:.|||:.||.|:..:::|:.||||||||||||.|
 Worm    93 NCSTSSTKLLVTKCSAHSSVICMGQRNFYKRIPCNWSSGYSWTKTMILSVVLGGFGADRFYLGLW 157

  Fly   247 QEGIGKLFSFGGLGVWTIIDVLLISMHYLGPADGSLYI 284
            :..||||||||||||||::||:||::.|:.|.|||:||
 Worm   158 KSAIGKLFSFGGLGVWTLVDVVLIAVGYIKPYDGSMYI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amxNP_001245591.1 TM2 219..268 CDD:282945 32/48 (67%)
C41D11.9NP_491372.1 TM2 130..179 CDD:282945 32/48 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162625
Domainoid 1 1.000 80 1.000 Domainoid score I5565
eggNOG 1 0.900 - - E1_KOG4272
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12275
Inparanoid 1 1.050 153 1.000 Inparanoid score I2935
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385397at2759
OrthoFinder 1 1.000 - - FOG0005547
OrthoInspector 1 1.000 - - oto19356
orthoMCL 1 0.900 - - OOG6_106920
Panther 1 1.100 - - LDO PTHR21016
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2847
SonicParanoid 1 1.000 - - X3965
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.