DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and CREB5

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_016868296.1 Gene:CREB5 / 9586 HGNCID:16844 Length:537 Species:Homo sapiens


Alignment Length:364 Identity:82/364 - (22%)
Similarity:129/364 - (35%) Gaps:102/364 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GGLLMGGHTPKTPEILNSLIAMTNPLENFSYSSAAAAAAAVSVASSSASCSAASTPV----VTVR 77
            ||.:.|   |.|.::  |...:.|...|.....|..:..:.||.:.:.|.:....||    .::.
Human   135 GGAMTG---PGTHQL--SSARLPNHDTNVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLL 194

  Fly    78 HFNGH-------------PN----GQS------HSQDSSHSSCSGSPLDSPAGTATTPSVQQTCS 119
            |.:..             ||    |.|      ..|.|.:||..|....:.:....:|.||...|
Human   195 HLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHS 259

  Fly   120 RLIKEGLKLSI------QSKRKLSTCD---SSSGSEQ-------------------PHSKYSRR- 155
            . .|..||.::      .|...::|..   ...||.|                   ||..|..: 
Human   260 E-AKMRLKAALTHHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQH 323

  Fly   156 -------------SSNHNGHSGSSNNYSG------------SMSNANDLDDDCEESSDDDSETKS 195
                         ..||..|...|:.::.            ...|...:....::.....:....
Human   324 QHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPP 388

  Fly   196 QPKG-----LTPEDEDRRRRR-RERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQL 254
            ||.|     :..||.|.|||: .|||:.|||:||.|::....:|.|::|.|...|::|:|:|..|
Human   389 QPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSML 453

  Fly   255 ETERQKLVDMLKSH-GCQRAGGCQLPSQLLQSPAQKYLS 292
            :.|..:|..:|.:| .|        |...:|..:|.|||
Human   454 KNEVAQLKQLLLTHKDC--------PITAMQKESQGYLS 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 19/52 (37%)
coiled coil 215..265 CDD:269870 18/49 (37%)
CREB5XP_016868296.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.