DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and CST6

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_012228.1 Gene:CST6 / 854775 SGDID:S000001298 Length:587 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:67/340 - (19%)
Similarity:125/340 - (36%) Gaps:90/340 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HTPKTPEILNSL-------------IAMTN-PLENFSYSSAAAAAAAVSVASSSASCSAASTPVV 74
            |....|.||.:|             :.||| |:...|............::.|:...|.....:.
Yeast   216 HALNDPSILETLSPFFQPFGVDVAHLPMTNPPIFQSSLPGCDEPIRRRRISISNGQISQLGEDIE 280

  Fly    75 TVRHFNG-----HPNGQSHSQDSSHSSCSGSPLDSPAGTATTPSVQQTCSRLIKEGLKLSIQSKR 134
            |:.:.:.     .||..:::..|...:.|..|:.:.|  ....|:.|             ..:|:
Yeast   281 TLENLHNTQPPPMPNFHNYNGLSQTRNVSNKPVFNQA--VPVSSIPQ-------------YNAKK 330

  Fly   135 KLS-TCDSSSGSEQPHSKYSRRSSNHNGHSGSSNNYSGSMSNANDLDDDCEESSDDD------SE 192
            .:: |.||:.|.:.  ..||:....:..::.|.|..:.|:|:...:......:..::      .|
Yeast   331 VINPTKDSALGDQS--VIYSKSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRE 393

  Fly   193 TKSQPKGLTPEDED--------------------RRRRRRERNKIAATKCRMKKRERTQNLIKE- 236
            :.|.| ..||:.:.                    :|.|..|||:|||:|||.:|:.....|.|| 
Yeast   394 SHSNP-SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKVAQLQLQKEF 457

  Fly   237 SEVLDTQNVELK--NQVRQLETERQKLVDM-LKSHGCQRAGGCQLPSQLLQSPAQKYLSELELET 298
            :|:.|...:.||  |...:|.::.:|...: |:.|            :.|...:..         
Yeast   458 NEIKDENRILLKKLNYYEKLISKFKKFSKIHLREH------------EKLNKDSDN--------- 501

  Fly   299 VSIDGPNSGNNNQRL 313
             :::|.||.|.|:.:
Yeast   502 -NVNGTNSSNKNESM 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 19/56 (34%)
coiled coil 215..265 CDD:269870 18/53 (34%)
CST6NP_012228.1 bZIP_ATF2 427..484 CDD:269835 21/56 (38%)
coiled coil 428..479 CDD:269835 21/50 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.