DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and Jdp2

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_011242520.1 Gene:Jdp2 / 81703 MGIID:1932093 Length:286 Species:Mus musculus


Alignment Length:76 Identity:38/76 - (50%)
Similarity:56/76 - (73%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 TKSQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETE 257
            ::..|:....|:|:||:||||:||:||.:||.||:|||:.|.:|||.|:..|.|||.|:.:|:.|
Mouse   183 SRQSPRFQLDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKLE 247

  Fly   258 RQKLVDMLKSH 268
            ||:|:.||..|
Mouse   248 RQQLILMLNRH 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 28/52 (54%)
coiled coil 215..265 CDD:269870 26/49 (53%)
Jdp2XP_011242520.1 PKc_like 128..>171 CDD:389743
bZIP_ATF3 205..258 CDD:269870 28/52 (54%)
coiled coil 205..249 CDD:269870 23/43 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833404
Domainoid 1 1.000 75 1.000 Domainoid score I9036
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003423
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5873
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.