DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and FOSL1

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_005429.1 Gene:FOSL1 / 8061 HGNCID:13718 Length:271 Species:Homo sapiens


Alignment Length:232 Identity:50/232 - (21%)
Similarity:96/232 - (41%) Gaps:77/232 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDM 264
            ::||:|:|||.||||||:||.|||.:::|.|..|..|::.|:.:...|:.::.:|:.::::|..:
Human   100 ISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELV 164

  Fly   265 LKSHGCQRAGGCQLPSQLLQSPAQKYLSELELETVSIDGPNSGNNNQRLQSIPSMATFKYGSKTA 329
            |::|    ...|::|                      :|...|:                   |.
Human   165 LEAH----RPICKIP----------------------EGAKEGD-------------------TG 184

  Fly   330 AAMAQQLPNGYCKPSPSAQEFEHAGYQQQQQQQQQQQPQSLNPAGNNVIDQQHANPSPSLLSDYV 394
            :......|...|:|.|..                     ||:|   ..:.:..|..:|:|::  .
Human   185 STSGTSSPPAPCRPVPCI---------------------SLSP---GPVLEPEALHTPTLMT--T 223

  Fly   395 PNCDGLTGS------ASNHPSHNNNNNNNNSSGASSN 425
            |:....|.|      ::..|..:.:..:::|||..|:
Human   224 PSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 16/52 (31%)
coiled coil 215..265 CDD:269870 15/49 (31%)
FOSL1NP_005429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..112 6/11 (55%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 107..127 14/19 (74%)
bZIP_Fos 115..168 CDD:269869 16/52 (31%)
coiled coil 115..167 CDD:269869 16/51 (31%)
PRK13729 129..>250 CDD:184281 28/191 (15%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 133..161 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..202 8/69 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..271 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143229
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.