DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and fosl1b

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_009293711.1 Gene:fosl1b / 793507 ZFINID:ZDB-GENE-091204-259 Length:200 Species:Danio rerio


Alignment Length:87 Identity:27/87 - (31%)
Similarity:52/87 - (59%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 CEESSDDDSETKSQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVEL 247
            |..:..|::|.....|.::.|:.::.|.|||||::||.:||.::|.....|..|::.|:....:|
Zfish   103 CNGAVGDNAEGHDDNKHVSSEELEKIRIRRERNRVAAARCRDRRRMLIDTLQNETDHLEHVKTQL 167

  Fly   248 KNQVRQLETERQKLVDMLKSHG 269
            :.::..||.||::|..:.::||
Zfish   168 EEEIATLERERERLELVFEAHG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 15/52 (29%)
coiled coil 215..265 CDD:269870 15/49 (31%)
fosl1bXP_009293711.1 bZIP 127..188 CDD:304365 20/60 (33%)
coiled coil 128..179 CDD:269834 18/50 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576075
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.