powered by:
Protein Alignment Atf3 and jdp2a
DIOPT Version :9
Sequence 1: | NP_001259125.1 |
Gene: | Atf3 / 43867 |
FlyBaseID: | FBgn0028550 |
Length: | 688 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005158991.1 |
Gene: | jdp2a / 570258 |
ZFINID: | ZDB-GENE-131127-459 |
Length: | 199 |
Species: | Danio rerio |
Alignment Length: | 66 |
Identity: | 38/66 - (57%) |
Similarity: | 52/66 - (78%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 203 EDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDMLKS 267
|:|:||:||||:||:||.:||.||:|||:.|.||||.|:..|.|||.|:.:|:.|||:|:.||..
Zfish 106 EEEERRKRRREKNKVAAARCRNKKKERTEYLQKESERLEMMNSELKAQIEELKHERQQLILMLNR 170
Fly 268 H 268
|
Zfish 171 H 171
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170576072 |
Domainoid |
1 |
1.000 |
77 |
1.000 |
Domainoid score |
I8768 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1414 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003423 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23351 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5873 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
8 | 7.870 |
|
Return to query results.
Submit another query.