DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and jdp2a

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_005158991.1 Gene:jdp2a / 570258 ZFINID:ZDB-GENE-131127-459 Length:199 Species:Danio rerio


Alignment Length:66 Identity:38/66 - (57%)
Similarity:52/66 - (78%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 EDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDMLKS 267
            |:|:||:||||:||:||.:||.||:|||:.|.||||.|:..|.|||.|:.:|:.|||:|:.||..
Zfish   106 EEEERRKRRREKNKVAAARCRNKKKERTEYLQKESERLEMMNSELKAQIEELKHERQQLILMLNR 170

  Fly   268 H 268
            |
Zfish   171 H 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 29/52 (56%)
coiled coil 215..265 CDD:269870 27/49 (55%)
jdp2aXP_005158991.1 bZIP_ATF3 120..171 CDD:269870 27/50 (54%)
coiled coil 120..168 CDD:269870 25/47 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576072
Domainoid 1 1.000 77 1.000 Domainoid score I8768
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003423
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5873
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.