DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and atf7b

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_005166106.1 Gene:atf7b / 567018 ZFINID:ZDB-GENE-030131-3028 Length:459 Species:Danio rerio


Alignment Length:375 Identity:92/375 - (24%)
Similarity:147/375 - (39%) Gaps:76/375 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSIDSGGLLMGGHTPKTPEILNSLIAMTNPLENFSYSSAAAAAAAVSVASSS---ASCSAASTPV 73
            |.|||.       .|.:|:   |..:|||     |..:.|.|..|:::..:.   ...:|:|||.
Zfish   109 LEIDSS-------PPDSPD---SASSMTN-----SKDTVAMAKEAIALRKAKDVPPRTAASSTPT 158

  Fly    74 VTVRHFNGHP-----NGQSHSQDSSHSSCSGSP----LDSPAGTATTPSVQ-----QTCSRLIKE 124
            .|:......|     :..:.:|.|..|..:.:|    |.||:|  :.|.:.     ||...|...
Zfish   159 PTIVRPGSLPLHQGFDSMNPTQPSPTSVITRTPPSNRLSSPSG--SFPMLMQLPNGQTVPLLPSP 221

  Fly   125 GLKLSIQSKRKLSTC------------DSSSGSEQPHSKYSRRSSNHNGHSGSSNNYSGSMSNAN 177
            |....|...|..:|.            .|||||..|        |.::.||.:......::|..:
Zfish   222 GQTSVISLARSSNTVPNIPGIPGPPIGGSSSGSSSP--------SGYSTHSDAKTRLKAALSQPS 278

  Fly   178 DLDDDCEESSDDDSETKS--QP-------------KGLTPEDEDRRRRRRERNKIAATKCRMKKR 227
            . .........|.:||.|  ||             :|...|.::||||..|||:.||::||.|::
Zfish   279 P-SGPAPIQKTDHTETPSPAQPQVSPAPPKGGRRRRGADIEPDERRRRFLERNRAAASRCRQKRK 342

  Fly   228 ERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDMLKSHGCQRAGGCQLPSQLLQSPAQKYLS 292
            .....|.|.:|.|...||.|..:|..|.||..:|.::|.:|........|..:.|.....:..:|
Zfish   343 VWVSALEKRAEELANANVSLTGEVSLLRTEVTRLKELLLAHKDCPVTAMQKKAYLAAGVDESSVS 407

  Fly   293 ELELETVSIDGPNSGNN-----NQRLQSIPSMATFKYGSKTAAAMAQQLP 337
            .|.: .|::..|.|.|.     .:.:..:..|.:.::.:....|.:|..|
Zfish   408 ALVM-PVTVPAPVSVNGLSVRAAEAVAVLAGMGSGQWSNSAGDASSQSQP 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 19/52 (37%)
coiled coil 215..265 CDD:269870 18/49 (37%)
atf7bXP_005166106.1 C2H2 Zn finger 9..31 CDD:275368
bZIP_ATF2 332..382 CDD:269835 18/49 (37%)
coiled coil 332..382 CDD:269835 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.