DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and creb5b

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_021322572.1 Gene:creb5b / 565910 ZFINID:ZDB-GENE-091020-6 Length:480 Species:Danio rerio


Alignment Length:305 Identity:70/305 - (22%)
Similarity:111/305 - (36%) Gaps:61/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NSLIAMTNPLENFSYSS---------------AAAAAAAVSVASSSASCSAASTPVVTVRHFNGH 82
            ::::.|..|..|.|.||               ||.|.....:|:.|.:.......::..|.   .
Zfish   193 SNMMGMQGPAHNNSCSSPHVPSMHSEAKLRLKAALAHHPGGMANGSMNSMGHMMEMMPSRQ---D 254

  Fly    83 PNGQSHSQDSSHSSCSGSPLDSPAGTATTPSVQQTCSRLIKEGLKLSIQSKRKLSTCDSSSGSEQ 147
            ..|..|.....|....|.|...|......||..|                        |.....|
Zfish   255 QTGHHHMHSHPHQHMQGPPHGYPHHGHHHPSHAQ------------------------SVHHHPQ 295

  Fly   148 PHSKYSRRSSN-HNGHSGSSNNYSGSMSNANDLDDDCEESSDDDSETKSQPKG-----LTPEDED 206
            .|..::...:: |..|...::.:....|.|:.|....::.....:.....|.|     :..||.|
Zfish   296 SHGHHNSHPAHMHPAHGHQTSPHQAMHSAASQLSPAAQQMQPTQTLQSPLPSGGRRRRVVDEDPD 360

  Fly   207 RRRRR-RERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDMLKSH-G 269
            .|||: .|||:.|||:||.|::....:|.|::|.|...|::|:|:|..|:.|..:|..:|.:| .
Zfish   361 ERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVTMLKNEVTQLKQLLLTHKD 425

  Fly   270 CQRAGGCQLPSQLLQSPAQKYLSELELETVSIDGPNSGNNNQRLQ 314
            |        |...:|..:|.|||.   |:.....|......|.:|
Zfish   426 C--------PITTMQKESQGYLSP---ESSPAGSPTPVTQQQVIQ 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 19/52 (37%)
coiled coil 215..265 CDD:269870 18/49 (37%)
creb5bXP_021322572.1 bZIP_ATF2 362..421 CDD:269835 23/58 (40%)
coiled coil 362..421 CDD:269835 23/58 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.