DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and batf

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_005160917.1 Gene:batf / 564589 ZFINID:ZDB-GENE-041014-291 Length:124 Species:Danio rerio


Alignment Length:158 Identity:45/158 - (28%)
Similarity:67/158 - (42%) Gaps:45/158 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 GSSNNYSGSMSNANDLDDDCEESSDDDSETKSQPKG--LTPEDEDRRRRRRERNKIAATKCRMKK 226
            ||.||                    |.|.|||...|  ....|:.|:..|||:|:|||.|.||::
Zfish     4 GSDNN--------------------DTSYTKSPSPGNKQGSSDDMRKVMRREKNRIAAQKSRMRQ 48

  Fly   227 RERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDMLKSHG--CQRAGGCQLPSQLLQSPAQK 289
            .::..:|..|||.|:.:|..|:.:|::|..|.:.|..:|.:|.  |....|.        ||...
Zfish    49 TQKADSLHLESESLEKENAALRKEVKRLTEEAKYLSTVLSNHEPLCTGLSGA--------SPELL 105

  Fly   290 YLSELELETVSIDGPNSGNNNQRLQSIP 317
            |            |.:.|..:|.: |:|
Zfish   106 Y------------GAHHGAFHQHI-SVP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 19/52 (37%)
coiled coil 215..265 CDD:269870 18/49 (37%)
batfXP_005160917.1 bZIP_BATF 27..84 CDD:269849 21/56 (38%)
coiled coil 29..83 CDD:269849 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576080
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.