DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and fosl2

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001076467.1 Gene:fosl2 / 558921 ZFINID:ZDB-GENE-070209-164 Length:341 Species:Danio rerio


Alignment Length:271 Identity:67/271 - (24%)
Similarity:117/271 - (43%) Gaps:71/271 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 SSDDDSETKSQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQ 250
            |..|....:.:.:.||||:|::||.||||||:||.|||.::||.|:.|..|:|.|:.:..:|:.:
Zfish   106 SIGDARGRRKRDEQLTPEEEEKRRVRRERNKLAAAKCRNRRRELTEMLQGETEKLEEEKADLQKE 170

  Fly   251 VRQLETERQKLVDMLKSHGCQRAGGCQLPSQLLQSPAQKYLSELELETVSIDGPNSGNNNQRLQS 315
            :..|:.|:.||..||.:|.    ..|:||      |.:::.|               :::|  |.
Zfish   171 IETLQKEKDKLEFMLVAHN----PVCKLP------PEERHQS---------------SHSQ--QC 208

  Fly   316 IPSMATFKYGSKTAAAMAQQLPNG--------YCKPSPSAQEFEHAGYQQQQQQQQQQ--QP--- 367
            :|...|.:         :..:|.|        ..|..|...:.:......::::.|..  :|   
Zfish   209 VPLPLTMR---------SNLVPRGPMNTLNPVVVKQEPLEDDDDDEDDDDEEEKVQHSVIKPICL 264

  Fly   368 ---------QSLNP---AGNNVIDQQHANPS-----PSLLSDYVPNCDGLTGSASNHPSHNNNNN 415
                     .|||.   |.:..:...: |||     ||:|....|:    ..|.|...:|..:::
Zfish   265 GGGMYCSDGDSLNTPVVAASTPVSTPN-NPSLIFTYPSMLEPESPS----PSSESCSKAHRRSSS 324

  Fly   416 NNNSSGASSNT 426
            :.:.|..|.|:
Zfish   325 SGDQSSDSLNS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 21/52 (40%)
coiled coil 215..265 CDD:269870 19/49 (39%)
fosl2NP_001076467.1 bZIP_Fos 135..188 CDD:269869 21/52 (40%)
coiled coil 135..187 CDD:269869 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576078
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.