DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and Batf

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_058047.1 Gene:Batf / 53314 MGIID:1859147 Length:125 Species:Mus musculus


Alignment Length:103 Identity:36/103 - (34%)
Similarity:57/103 - (55%) Gaps:4/103 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SDDDSETKSQPKGLTPEDED-RRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQ 250
            |.|.|.::|.|.|.....:| |:.:|||:|:|||.|.|.::.::...|..|||.|:.||..|:.:
Mouse     7 SSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKE 71

  Fly   251 VRQLETERQKLVDMLKSHG--CQ-RAGGCQLPSQLLQS 285
            ::||..|.:....:|.||.  |. .|.|...|.:::.|
Mouse    72 IKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYS 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 18/52 (35%)
coiled coil 215..265 CDD:269870 17/49 (35%)
BatfNP_058047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59 19/51 (37%)
bZIP_BATF 26..83 CDD:269849 22/56 (39%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 28..50 10/21 (48%)
coiled coil 29..80 CDD:269849 20/50 (40%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 54..75 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833409
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.