DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and ATF3

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001025458.1 Gene:ATF3 / 467 HGNCID:785 Length:181 Species:Homo sapiens


Alignment Length:198 Identity:64/198 - (32%)
Similarity:94/198 - (47%) Gaps:64/198 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 HPNGQSHSQDSSHSSCSGSPLDSPAGTAT-------TPSVQQTCSRLIKEGLKLSIQSK----RK 135
            || ||..:.:.|.|:.  .|..||.|:..       ||        .:||.|:.:||:|    |.
Human     5 HP-GQVSASEVSASAI--VPCLSPPGSLVFEDFANLTP--------FVKEELRFAIQNKHLCHRM 58

  Fly   136 LSTCDSSSGSEQPHSKYSRRSSNHNGHSGSSNNYSGSMSNANDLDDDCEESSDDDSETKSQPKGL 200
            .|..:|.:.|::|...                                       |.||::   :
Human    59 SSALESVTVSDRPLGV---------------------------------------SITKAE---V 81

  Fly   201 TPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDML 265
            .||:::|::||||||||||.|||.||:|:|:.|.||||.|::.|.|||.|:.:|:.|:|.|:.||
Human    82 APEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYML 146

  Fly   266 KSH 268
            ..|
Human   147 NLH 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 29/52 (56%)
coiled coil 215..265 CDD:269870 27/49 (55%)
ATF3NP_001025458.1 Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 88..110 16/21 (76%)
bZIP_ATF3 96..149 CDD:269870 29/52 (56%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 114..142 14/27 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143230
Domainoid 1 1.000 75 1.000 Domainoid score I9074
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003423
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5873
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.