DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and jdp2b

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001002493.1 Gene:jdp2b / 436766 ZFINID:ZDB-GENE-040718-197 Length:156 Species:Danio rerio


Alignment Length:87 Identity:39/87 - (44%)
Similarity:58/87 - (66%) Gaps:13/87 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 DCEESSDDDSETKSQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVE 246
            |..:|.|||             |::|::||||:||:||.:||.:|:|||..|.||||.|:..|.:
Zfish    60 DAIKSEDDD-------------DDERKKRRREKNKVAAARCRNRKKERTDFLQKESERLEMLNSD 111

  Fly   247 LKNQVRQLETERQKLVDMLKSH 268
            ||:|:.:|::|||:|:.||..|
Zfish   112 LKSQIEELKSERQQLIVMLNLH 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 27/52 (52%)
coiled coil 215..265 CDD:269870 25/49 (51%)
jdp2bNP_001002493.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..95 19/47 (40%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 72..94 12/21 (57%)
bZIP_ATF3 80..133 CDD:269870 27/52 (52%)
coiled coil 80..130 CDD:269870 25/49 (51%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 98..126 14/27 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576073
Domainoid 1 1.000 77 1.000 Domainoid score I8768
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003423
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5873
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.