DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and fosab

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_991132.1 Gene:fosab / 394198 ZFINID:ZDB-GENE-031222-4 Length:349 Species:Danio rerio


Alignment Length:400 Identity:84/400 - (21%)
Similarity:156/400 - (39%) Gaps:101/400 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SSASCSAASTPVVTVRHFNGHPNGQSHS-QDSSHSSCSGSPLDSPAGTATTPSVQQTCSRLIKEG 125
            :|:.||.||....:|.::   |..|:.. .|.|.||.|..|  :....::.|.:|.....:|   
Zfish    12 ASSRCSTASPSGDSVGYY---PLNQTQEFTDLSVSSASFVP--TVTAISSCPDLQWMVQPMI--- 68

  Fly   126 LKLSIQSKRKLSTCDSSSGSEQPHSKYSRRSSNHNGHSGSSNNYSGSMSNANDLDDDCEESSDDD 190
                       |:...|:|:.|          ::|..|......:|:.:                
Zfish    69 -----------SSVAPSNGAAQ----------SYNPSSYPKMRVTGAKT---------------- 96

  Fly   191 SETKSQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLE 255
            |..:|:.:.|:||:|:::|.||||||:||.|||.::||.|..|..|::.|:.:...|:|.:..|.
Zfish    97 SNKRSRSEQLSPEEEEKKRVRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQNDIANLL 161

  Fly   256 TERQKLVDMLKSHGCQRAGGCQLPSQL-LQSPAQKYLSEL---ELETVSI--DGPNSG--NNNQR 312
            .|:::|..:|.:|    ...|::|:.. ...|:...:..:   |:.|.|:  ..||:.  .::..
Zfish   162 KEKERLEFILAAH----KPICKIPADASFPEPSSSPMGSISVPEIVTTSVVSSTPNTSITTSSSS 222

  Fly   313 LQSIPSMATFKYGS--------------------KTAAAMAQQLPNGYCKPSPSAQEFEHAGYQQ 357
            |....:.:|..:.|                    |.....|:.:|:         .:..::.|.|
Zfish   223 LLFSSTASTDSFSSTTVKISDLEPTLEESLELLAKAELETARSVPD---------MDLSNSLYTQ 278

  Fly   358 QQQQQQQQQPQSLNPAGNNVIDQQHANPSPSLLSDYVPNCDGLTGS-ASNHPSHNNNNNNNNSSG 421
            ..:.........|.|....|:             ...|.|...|.| ...:|.::....:.:..|
Zfish   279 DWEPLYTPANTDLEPLCTPVV-------------TCTPACTTYTSSFMFTYPENDVFPTSVHRRG 330

  Fly   422 ASSNTSNNNS 431
            :|||..:::|
Zfish   331 SSSNDQSSDS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 19/52 (37%)
coiled coil 215..265 CDD:269870 18/49 (37%)
fosabNP_991132.1 bZIP_Fos 113..174 CDD:269869 24/60 (40%)
coiled coil 114..173 CDD:269869 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576074
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.