DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and Batf3

DIOPT Version :10

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_084336.1 Gene:Batf3 / 381319 MGIID:1925491 Length:118 Species:Mus musculus


Alignment Length:74 Identity:27/74 - (36%)
Similarity:51/74 - (68%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 SQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQ 259
            :||:  :|:|:||:.||||:|::||.:.|.|:.::...|.:|.|.|:.:|..|:.::.:|:.|.:
Mouse    20 NQPQ--SPKDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEHESLEQENSVLRREISKLKEELR 82

  Fly   260 KLVDMLKSH 268
            .|.::||.|
Mouse    83 HLSEVLKEH 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 16/52 (31%)
coiled coil 215..265 CDD:269870 14/49 (29%)
Batf3NP_084336.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 20/50 (40%)
bZIP 28..85 CDD:473870 19/56 (34%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 30..55 10/24 (42%)
coiled coil 31..82 CDD:269834 17/50 (34%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 56..84 8/27 (30%)

Return to query results.
Submit another query.