DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and Batf3

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_084336.1 Gene:Batf3 / 381319 MGIID:1925491 Length:118 Species:Mus musculus


Alignment Length:74 Identity:27/74 - (36%)
Similarity:51/74 - (68%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 SQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQ 259
            :||:  :|:|:||:.||||:|::||.:.|.|:.::...|.:|.|.|:.:|..|:.::.:|:.|.:
Mouse    20 NQPQ--SPKDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEHESLEQENSVLRREISKLKEELR 82

  Fly   260 KLVDMLKSH 268
            .|.::||.|
Mouse    83 HLSEVLKEH 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 16/52 (31%)
coiled coil 215..265 CDD:269870 14/49 (29%)
Batf3NP_084336.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 20/50 (40%)
bZIP 28..85 CDD:304365 19/56 (34%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 30..55 10/24 (42%)
coiled coil 31..82 CDD:269834 17/50 (34%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 56..84 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833411
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.