powered by:
Protein Alignment Atf3 and Batf3
DIOPT Version :9
Sequence 1: | NP_001259125.1 |
Gene: | Atf3 / 43867 |
FlyBaseID: | FBgn0028550 |
Length: | 688 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_084336.1 |
Gene: | Batf3 / 381319 |
MGIID: | 1925491 |
Length: | 118 |
Species: | Mus musculus |
Alignment Length: | 74 |
Identity: | 27/74 - (36%) |
Similarity: | 51/74 - (68%) |
Gaps: | 2/74 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 195 SQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQ 259
:||: :|:|:||:.||||:|::||.:.|.|:.::...|.:|.|.|:.:|..|:.::.:|:.|.:
Mouse 20 NQPQ--SPKDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEHESLEQENSVLRREISKLKEELR 82
Fly 260 KLVDMLKSH 268
.|.::||.|
Mouse 83 HLSEVLKEH 91
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167833411 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1414 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23351 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.840 |
|
Return to query results.
Submit another query.