DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and pcr1

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_594500.1 Gene:pcr1 / 2542047 PomBaseID:SPAC21E11.03c Length:171 Species:Schizosaccharomyces pombe


Alignment Length:182 Identity:48/182 - (26%)
Similarity:79/182 - (43%) Gaps:37/182 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 DEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDMLKSH 268
            |:::|||..|||:|||:|.|.||:|..:.|.:.:.....|:..|:..:.||:.|..:|...|.:|
pombe     9 DDEKRRRILERNRIAASKFRQKKKEWIKELEQTANAAFEQSKRLQLLLSQLQQEAFRLKSQLLAH 73

  Fly   269 -GCQRAGGCQLPSQLLQSPAQKYLSELELETVSID--GPNSGNNNQRLQSIPSMATFKYGSKTAA 330
             |||    |.:..:.:.:..|...:.|..:.::..  .|..|:|  .|:|:.|::.         
pombe    74 QGCQ----CSVKIRSVLTDFQTAHNALHSQHMAYRPVQPPPGDN--MLESVVSVSP--------- 123

  Fly   331 AMAQQLPNGYCKPSPSAQEFEHAGYQQQQQQQQQQQPQSLNPAGNNVIDQQH 382
                      .:..||.|..       ...|..|..|.|..|..::|  |||
pombe   124 ----------TQMHPSLQGL-------PPNQHPQMPPSSQQPNSDDV--QQH 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 17/52 (33%)
coiled coil 215..265 CDD:269870 16/49 (33%)
pcr1NP_594500.1 bZIP_ATF2 12..72 CDD:269835 22/59 (37%)
coiled coil 12..72 CDD:269835 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.