DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and atf21

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_595707.1 Gene:atf21 / 2540363 PomBaseID:SPBC2F12.09c Length:355 Species:Schizosaccharomyces pombe


Alignment Length:289 Identity:74/289 - (25%)
Similarity:117/289 - (40%) Gaps:47/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GHTPKTPEILNSL-IAMTNPLENFSYSSAAAAAAAVSVASSSASCSAASTPVVTVRHFNG----- 81
            ||..|.||..:.: :..|..|...|.::............|:....:..:...|:.|:|.     
pombe    91 GHYLKGPERTSEVSLPQTVNLSEISNNNDKGQPTNTPPVRSTIVAPSLYSEGSTLNHYNNGSHQV 155

  Fly    82 -HPNGQSHSQDSSHSSCSGSPLDSPAGTATTPSVQQTCSRLIKEGLKLS-IQSKRKLSTCDSSSG 144
             ||..|:                   || ..|.|.|  |.|::..:.|: .:.::.|....:|:.
pombe   156 LHPQFQN-------------------GT-NAPYVVQ--SNLMQNNVNLTGAEQEKGLDLYKNSAT 198

  Fly   145 SEQPHSKYSRRSSNHNGHSGSSNNYSGSMS-NANDLDDDCEESSDDDSETKSQP---------KG 199
            :......|:..|....|:..|:...|.|.: :.|..|:.|...:...|:.:..|         ..
pombe   199 ANNDEIFYNLESLRREGYLNSNKKQSQSPNGDYNSSDESCSNKTVASSQRRGTPGSNNVHTASNN 263

  Fly   200 LTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDM 264
            .||  :.:|||..|||:|||:|||.||:..||||.|.:.:...|:..|:..|.||..|...|.:.
pombe   264 ETP--DMKRRRFLERNRIAASKCRQKKKLWTQNLEKTAHIACEQSKALRILVSQLREEVICLKNQ 326

  Fly   265 LKSH-GCQRAGGCQLPSQLLQSPAQKYLS 292
            |.:| .|    .|:...|.|.|.||..:|
pombe   327 LLAHQDC----NCEGIRQYLSSEAQGIMS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 22/52 (42%)
coiled coil 215..265 CDD:269870 21/49 (43%)
atf21NP_595707.1 bZIP_ATF2 269..329 CDD:269835 27/59 (46%)
coiled coil 269..329 CDD:269835 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.