DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and FOSL2

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_006712039.1 Gene:FOSL2 / 2355 HGNCID:3798 Length:343 Species:Homo sapiens


Alignment Length:271 Identity:65/271 - (23%)
Similarity:110/271 - (40%) Gaps:86/271 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LTPEDEDRRRRRRERNKIAATKCRMKKRERTQNL-----------------IKESEVLDTQNVEL 247
            |:||:|::||.||||||:||.|||.::||.|:.|                 .:|:|.|:.:...|
Human   119 LSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAIGPWQVAVPHIPLFPWQETEELEEEKSGL 183

  Fly   248 KNQVRQLETERQKLVDMLKSHGCQRAGGCQLPSQLLQSPAQKYLSELELETVSIDGPNSGNNNQR 312
            :.::.:|:.|::||..||.:||    ..|::..:..:||....|..:          .||     
Human   184 QKEIAELQKEKEKLEFMLVAHG----PVCKISPEERRSPPAPGLQPM----------RSG----- 229

  Fly   313 LQSIPSMATFKYGSKTAAAMAQQLPNGYCKPSPSAQEFEHAGYQQQQQ--------------QQQ 363
                        |....|.:.:|.|.....||.|:     ||..:.|:              ::.
Human   230 ------------GGSVGAVVVKQEPLEEDSPSSSS-----AGLDKAQRSVIKPISIAGGFYGEEP 277

  Fly   364 QQQP------QSLNPAGNNVIDQQHANPSPSLLSDYVPNCDGLTGSASNHPSHNNNNNNNNSSGA 422
            ...|      .::.|..:|::...     ||:|....|        ||...|.:..:..::|||.
Human   278 LHTPIVVTSTPAVTPGTSNLVFTY-----PSVLEQESP--------ASPSESCSKAHRRSSSSGD 329

  Fly   423 SSNTSNNNSNI 433
            .|:.|.|:..:
Human   330 QSSDSLNSPTL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 21/69 (30%)
coiled coil 215..265 CDD:269870 19/66 (29%)
FOSL2XP_006712039.1 bZIP_Fos 134..204 CDD:269869 21/69 (30%)
coiled coil 134..195 CDD:269869 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143231
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.