DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and FOS

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_005243.1 Gene:FOS / 2353 HGNCID:3796 Length:380 Species:Homo sapiens


Alignment Length:495 Identity:110/495 - (22%)
Similarity:184/495 - (37%) Gaps:172/495 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SSSASCSAASTPVVTVRHFNGHPNGQS----HSQDSSHSSCSGSPLDS---------------PA 106
            :||:.||:||            |.|.|    ||...|.|| .|||:::               |.
Human    12 ASSSRCSSAS------------PAGDSLSYYHSPADSFSS-MGSPVNAQDFCTDLAVSSANFIPT 63

  Fly   107 GTA--TTPSVQQTCSRLIKEGLKLSIQSKRKLSTCDSSSGSEQPH---------SKYSRRSSNHN 160
            .||  |:|.:|.    |::..|..|:          :.|.:..||         ..|||      
Human    64 VTAISTSPDLQW----LVQPALVSSV----------APSQTRAPHPFGVPAPSAGAYSR------ 108

  Fly   161 GHSGSSNNYSGSMSNANDLDDDCEESSDDDSETKSQPKGLTPEDEDRRRRRRERNKIAATKCRMK 225
              :|.....:|..:.:.......|:              |:||:|::||.||||||:||.|||.:
Human   109 --AGVVKTMTGGRAQSIGRRGKVEQ--------------LSPEEEEKRRIRRERNKMAAAKCRNR 157

  Fly   226 KRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDMLKSHGCQRAGGCQLPSQLLQSPAQKY 290
            :||.|..|..|::.|:.:...|:.::..|..|::||..:|.:|    ...|::|..|      .:
Human   158 RRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAH----RPACKIPDDL------GF 212

  Fly   291 LSELELETVSIDGPNSGNNNQRLQSIPSMATFKYGSKTAAAMAQQLPNGYCKPSPSAQEFEHAGY 355
            ..|:.:.::.:.|           .:|.:||    .::..|....|.|. .:|.||.:..:..  
Human   213 PEEMSVASLDLTG-----------GLPEVAT----PESEEAFTLPLLND-PEPKPSVEPVKSI-- 259

  Fly   356 QQQQQQQQQQQP--QSLNPAGNNVIDQQHANPSPSLLSDYVPNCDGLTGS---ASNHPSHNNNNN 415
               ...:.:.:|  ..|.||.        :.||.|..:..||:.| |:||   |...|.|     
Human   260 ---SSMELKTEPFDDFLFPAS--------SRPSGSETARSVPDMD-LSGSFYAADWEPLH----- 307

  Fly   416 NNNSSGASSNTSNNNSNISSHSSNATSSTTPTATSSAIEFVKNELVDSQSPYTTALSAERFLFEP 480
                        :.:..:...::......||..|.:          .|.:.||::..   |.:..
Human   308 ------------SGSLGMGPMATELEPLCTPVVTCT----------PSCTAYTSSFV---FTYPE 347

  Fly   481 SDGFPDIKHACVLPSPCGINGLNMASVVNTNGSTGNNNNS 520
            :|.||    :|              :..:..||:.|..:|
Human   348 ADSFP----SC--------------AAAHRKGSSSNEPSS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 19/52 (37%)
coiled coil 215..265 CDD:269870 18/49 (37%)
FOSNP_005243.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..138 4/32 (13%)
Basic motif, required for the activation of phospholipid synthesis, but not for CDS1-binding 139..159 13/19 (68%)
bZIP_Fos 147..200 CDD:269869 19/52 (37%)
coiled coil 147..199 CDD:269869 19/51 (37%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 165..193 6/27 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..380 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143228
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.