DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and fos-1

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001033481.1 Gene:fos-1 / 178987 WormBaseID:WBGene00001345 Length:467 Species:Caenorhabditis elegans


Alignment Length:264 Identity:57/264 - (21%)
Similarity:96/264 - (36%) Gaps:70/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 SSGSEQPHSKYSRRSSNHNGHSGSSNNYSGSMSNANDLDDDCEESSDDDSETKSQPKGLTPEDED 206
            |:.:..|..:||....:..|.....                 |::.:||             |:|
 Worm   130 STAASSPMVQYSTVKKSSAGRKPKE-----------------EDNMEDD-------------DDD 164

  Fly   207 RRRRRRERNKIAATKCRMKKRERTQNLIKE--SEVLDTQNVELKN--QVRQLETERQKLVDMLKS 267
            :|.:||:|||.||.:|    |:|..:|:||  .:|.|.:|...|.  :...:..:...|.:.|::
 Worm   165 KRLKRRQRNKEAAARC----RQRRIDLMKELQDQVNDFKNSNDKKMAECNNIRNKLNSLKNYLET 225

  Fly   268 HGCQ--------RAGGCQLPSQLLQSPAQKYLSELELETVSIDGPNSGNNNQRLQSIPSMATFKY 324
            |.|:        ......:|...: .|:|.||.    .::.:..|       |..|:|......:
 Worm   226 HDCKLSREERTHEINRLIIPPSTV-PPSQPYLQ----HSLRVHPP-------RADSVPYSIRSGH 278

  Fly   325 GSKTAAAMAQQLPNGYCKPS------PSAQEFEHAGYQQQQQQQQQQQPQSLNPAGNNVIDQ--- 380
            .|.::   .|..|....|||      |.....::...:..........|.|.:.||.:||..   
 Worm   279 SSSSS---EQHSPVEDYKPSIDQLLLPPISCIQNIKDRNINSMPPPALPASTSAAGIHVITSIPV 340

  Fly   381 QHAN 384
            .|||
 Worm   341 SHAN 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 16/56 (29%)
coiled coil 215..265 CDD:269870 15/53 (28%)
fos-1NP_001033481.1 bZIP_Fos_like 165..223 CDD:269847 19/61 (31%)
coiled coil 166..223 CDD:269847 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.