DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and zip-11

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_500318.1 Gene:zip-11 / 177099 WormBaseID:WBGene00021082 Length:228 Species:Caenorhabditis elegans


Alignment Length:196 Identity:47/196 - (23%)
Similarity:78/196 - (39%) Gaps:26/196 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 HFNGHPNGQSHSQDSSHSSC---SGSPLDSPAGTATTPSVQQTCSRLIKEGLKLSIQSKRKLSTC 139
            |.:.:|:...|     |:.|   ...|.|.|..|:...||..:...|.:..|.............
 Worm    28 HHHHYPHSSVH-----HTECYQTLSCPSDLPVETSYYNSVPPSYQDLGQTDLSPQFWCAEVDCVH 87

  Fly   140 DSSSGSEQPH--SKYSRRSSNHNGHSGSS-----------NNYSGSMSNANDLDDDCEESSDDDS 191
            :..|..|.||  ||.....|....|..:|           .|.:......|||.|...::.|:  
 Worm    88 ERCSTKEIPHEQSKIFEEISKECDHIMNSAGDCEKCQVEHENGAQEAIPINDLVDIVMQTVDN-- 150

  Fly   192 ETKSQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLET 256
               .:.:|.:.::.....|:|::||:||.:.|.|::.:.|:|:.:.|..:.:|..||.|...||.
 Worm   151 ---LKKEGSSNDETKLLSRKRQQNKVAAARYRDKQKAKWQDLLDQLEAEEDRNQRLKLQAGHLEK 212

  Fly   257 E 257
            |
 Worm   213 E 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 16/43 (37%)
coiled coil 215..265 CDD:269870 16/43 (37%)
zip-11NP_500318.1 bZIP_ATF4 166..224 CDD:269840 18/48 (38%)
coiled coil 166..215 CDD:269840 18/48 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.