Sequence 1: | NP_001259125.1 | Gene: | Atf3 / 43867 | FlyBaseID: | FBgn0028550 | Length: | 688 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500318.1 | Gene: | zip-11 / 177099 | WormBaseID: | WBGene00021082 | Length: | 228 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 47/196 - (23%) |
---|---|---|---|
Similarity: | 78/196 - (39%) | Gaps: | 26/196 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 HFNGHPNGQSHSQDSSHSSC---SGSPLDSPAGTATTPSVQQTCSRLIKEGLKLSIQSKRKLSTC 139
Fly 140 DSSSGSEQPH--SKYSRRSSNHNGHSGSS-----------NNYSGSMSNANDLDDDCEESSDDDS 191
Fly 192 ETKSQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLET 256
Fly 257 E 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Atf3 | NP_001259125.1 | bZIP_ATF3 | 215..268 | CDD:269870 | 16/43 (37%) |
coiled coil | 215..265 | CDD:269870 | 16/43 (37%) | ||
zip-11 | NP_500318.1 | bZIP_ATF4 | 166..224 | CDD:269840 | 18/48 (38%) |
coiled coil | 166..215 | CDD:269840 | 18/48 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23351 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |