DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and Fosl2

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_032063.2 Gene:Fosl2 / 14284 MGIID:102858 Length:326 Species:Mus musculus


Alignment Length:250 Identity:68/250 - (27%)
Similarity:113/250 - (45%) Gaps:50/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDM 264
            |:||:|::||.||||||:||.|||.::||.|:.|..|:|.|:.:...|:.::.:|:.|::||..|
Mouse   119 LSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFM 183

  Fly   265 LKSHGCQRAGGCQLPSQLLQSPAQKYLSELELETVSIDGPNSGNNNQRLQSIPSMATFKYGSKTA 329
            |.:||    ..|::..:..:||                 |.||     |||:...     ||...
Mouse   184 LVAHG----PVCKISPEERRSP-----------------PTSG-----LQSLRGT-----GSAVG 217

  Fly   330 AAMAQQLPNGYCKPSPSAQEFEHAGYQQQQQQQQQQQPQSLNPAGNNVIDQQHANPSPSLLSDYV 394
            ..:.:|.|.....||.||        ...:.|:...:|.|:  ||.....::     |......|
Mouse   218 PVVVKQEPPEEDSPSSSA--------GMDKTQRSVIKPISI--AGGGFYGEE-----PLHTPIVV 267

  Fly   395 PNCDGLTGSASN----HPSHNNNNNNNNSSGASSNTSNNNSNISSHSSNATSSTT 445
            .:...:|...||    :|:.....:.::.|.:.|.....:|:....||::.:|.|
Mouse   268 TSTPAITPGTSNLVFTYPNVLEQESPSSPSESCSKAHRRSSSSGDQSSDSLNSPT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 21/52 (40%)
coiled coil 215..265 CDD:269870 19/49 (39%)
Fosl2NP_032063.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..131 6/11 (55%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 126..128 0/1 (0%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 129..136 5/6 (83%)
bZIP_Fos 134..187 CDD:269869 21/52 (40%)
coiled coil 134..186 CDD:269869 21/51 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..244 17/85 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..326 7/37 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833408
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.