DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and JDP2

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_016876460.1 Gene:JDP2 / 122953 HGNCID:17546 Length:206 Species:Homo sapiens


Alignment Length:106 Identity:47/106 - (44%)
Similarity:66/106 - (62%) Gaps:8/106 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 KSQP-KGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETE 257
            :.|| |....|:|:||:||||:||:||.:||.||:|||:.|.:|||.|:..|.|||.|:.:|:.|
Human   103 RPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQE 167

  Fly   258 RQKLVDMLKSH--GC-QRAGGCQLPSQLLQSPAQKYLSELE 295
            ||:|:.||..|  .| .|....:.|    :|.....|.:||
Human   168 RQQLILMLNRHRPTCIVRTDSVKTP----ESEGNPLLEQLE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 28/52 (54%)
coiled coil 215..265 CDD:269870 26/49 (53%)
JDP2XP_016876460.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143227
Domainoid 1 1.000 75 1.000 Domainoid score I9074
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003423
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5873
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.