DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and Jdp2

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_008762956.1 Gene:Jdp2 / 116674 RGDID:621611 Length:312 Species:Rattus norvegicus


Alignment Length:260 Identity:71/260 - (27%)
Similarity:106/260 - (40%) Gaps:57/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ENFSYSSAAAAAA---------AVSVASSSASCS-AASTPVVTVRHFNGHPNGQSHSQDSSHSSC 97
            :.||...|||.|:         .|:.|..|..|: ..:..|:..|.......|....:|::.:|.
  Rat    48 KGFSAHPAAAFASLPPRLCSILGVAAARPSRGCAYITARRVLLPRALGSRGRGAPPDRDAAGTSA 112

  Fly    98 SGSPLDSPAGTATTPSVQQTCSRLIKEGLKLSIQSKRKLSTCDSSSGSEQPHSKYSRRSSNHNGH 162
                    ||....|..::...|. :||.              ...|.|.|..:.:...:...|.
  Rat   113 --------AGPGPVPQAEEREHRR-EEGA--------------GGGGGEAPPGRPATPPAMMPGQ 154

  Fly   163 SGSSNNYSGSMSNANDLDD------DCEESSDDDSET-----------------KSQP-KGLTPE 203
            ....:..:||:.....|..      ..||....|...                 :.|| |....|
  Rat   155 IPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPLHFLEVKLGKRPQPVKSELDE 219

  Fly   204 DEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDMLKSH 268
            :|:||:||||:||:||.:||.||:|||:.|.:|||.|:..|.|||.|:.:|:.|||:|:.||..|
  Rat   220 EEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKLERQQLILMLNRH 284

  Fly   269  268
              Rat   285  284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 28/52 (54%)
coiled coil 215..265 CDD:269870 26/49 (53%)
Jdp2XP_008762956.1 PKc_like 167..>210 CDD:304357 4/42 (10%)
bZIP_ATF3 231..284 CDD:269870 28/52 (54%)
coiled coil 231..281 CDD:269870 26/49 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336959
Domainoid 1 1.000 75 1.000 Domainoid score I8840
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003423
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.