DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and BATF2

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_612465.3 Gene:BATF2 / 116071 HGNCID:25163 Length:274 Species:Homo sapiens


Alignment Length:248 Identity:59/248 - (23%)
Similarity:99/248 - (39%) Gaps:62/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 TKSQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETE 257
            |::.||      |.:|:.::::|:.||.:.|.|..::...|.::.|.|:..|:.|:.:::.|:.|
Human    11 TQTDPK------EQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALRKEIQSLQAE 69

  Fly   258 ----------RQKLVDM-------------------LKSHGCQRAGGCQLPSQLLQSPAQKYLSE 293
                      .::|..|                   |...|.|...||:...:|.|:|...|   
Human    70 LAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCY--- 131

  Fly   294 LELETVSIDGPNSGNNNQRLQ-SIPSMATFKYGSKTAAAMAQQLPNGYCKPSPSAQEF-EHAGYQ 356
             ..:.:| .||...::...|| .:||::   .|....|....||       |||...| .|.|  
Human   132 -PAQPLS-PGPQPHDSPSLLQCPLPSLS---LGPAVVAEPPVQL-------SPSPLLFASHTG-- 182

  Fly   357 QQQQQQQQQQPQSLNPAGNNVIDQQHANPSPSLLSDYVPNCDGLTGSASNHPS 409
             ...|....:..:|.|:    :..|.|.|.|..|..  |. .|..||:.::||
Human   183 -SSLQGSSSKLSALQPS----LTAQTAPPQPLELEH--PT-RGKLGSSPDNPS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 15/81 (19%)
coiled coil 215..265 CDD:269870 14/78 (18%)
BATF2NP_612465.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 11/41 (27%)
bZIP_BATF 17..74 CDD:269849 14/56 (25%)
coiled coil 19..73 CDD:269849 13/53 (25%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 20..41 6/20 (30%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 45..66 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..151 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..229 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143226
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.