Sequence 1: | NP_001259125.1 | Gene: | Atf3 / 43867 | FlyBaseID: | FBgn0028550 | Length: | 688 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_612465.3 | Gene: | BATF2 / 116071 | HGNCID: | 25163 | Length: | 274 | Species: | Homo sapiens |
Alignment Length: | 248 | Identity: | 59/248 - (23%) |
---|---|---|---|
Similarity: | 99/248 - (39%) | Gaps: | 62/248 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 193 TKSQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETE 257
Fly 258 ----------RQKLVDM-------------------LKSHGCQRAGGCQLPSQLLQSPAQKYLSE 293
Fly 294 LELETVSIDGPNSGNNNQRLQ-SIPSMATFKYGSKTAAAMAQQLPNGYCKPSPSAQEF-EHAGYQ 356
Fly 357 QQQQQQQQQQPQSLNPAGNNVIDQQHANPSPSLLSDYVPNCDGLTGSASNHPS 409 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Atf3 | NP_001259125.1 | bZIP_ATF3 | 215..268 | CDD:269870 | 15/81 (19%) |
coiled coil | 215..265 | CDD:269870 | 14/78 (18%) | ||
BATF2 | NP_612465.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..47 | 11/41 (27%) | |
bZIP_BATF | 17..74 | CDD:269849 | 14/56 (25%) | ||
coiled coil | 19..73 | CDD:269849 | 13/53 (25%) | ||
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 20..41 | 6/20 (30%) | |||
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 45..66 | 5/20 (25%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 128..151 | 5/27 (19%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 187..229 | 13/48 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143226 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1414 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23351 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.840 |