DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and ATF7-NPFF

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001353488.1 Gene:ATF7-NPFF / 114108587 HGNCID:55073 Length:463 Species:Homo sapiens


Alignment Length:334 Identity:77/334 - (23%)
Similarity:122/334 - (36%) Gaps:100/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PASSLLSIDSGGLLMGGHTPKTPEILNSLIAMTNPLENFSYSSAAAAAAAVSVASSSASCSAAST 71
            |.|.:.........||..|...|.:::.....|.|:   .........:.:|:|          .
Human   172 PTSVITQAPPSNRQMGSPTGSLPLVMHLANGQTMPV---LPGPPVQMPSVISLA----------R 223

  Fly    72 PVVTVRHFNGHPNGQSHSQDSSHSSCSGSPLDSPAGTATTPSVQQTCSRLIKEGLKLSIQSKRKL 136
            ||..|.:..|.|....:|  |...|.||.|:.|.|                |..||.::      
Human   224 PVSMVPNIPGIPGPPVNS--SGSISPSGHPIPSEA----------------KMRLKATL------ 264

  Fly   137 STCDSSSGSEQPHSKYSRRSSNHNGHSGSSNNYSGSMSNANDLDDDCEES----SDDDSETKSQP 197
                            :.:.|:.||..|.....:.:|..|..     |:|    ...|:.:.:||
Human   265 ----------------THQVSSINGGCGMVVGTASTMVTARP-----EQSQILIQHPDAPSPAQP 308

  Fly   198 KGLTP----------------EDEDRRRRR-RERNKIAATKCRMKKRERTQNLIKESEVLDTQNV 245
            : ::|                ||.|.||:| .|||:.||::||.|::....:|.|::|.|.:||:
Human   309 Q-VSPAQPTPSTGGRRRRTVDEDPDERRQRFLERNRAAASRCRQKRKLWVSSLEKKAEELTSQNI 372

  Fly   246 ELKNQVRQLETERQKLVDMLKSH-GCQRAGGCQLPSQLLQSPAQKYLSELELE-----------T 298
            :|.|:|..|..|..:|..:|.:| .|        |...||...|.||...:..           |
Human   373 QLSNEVTLLRNEVAQLKQLLLAHKDC--------PVTALQKKTQGYLGGRQRTPPTTGCPDLWVT 429

  Fly   299 VSIDGPNSG 307
            |::..|.:|
Human   430 VALPAPGNG 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 19/52 (37%)
coiled coil 215..265 CDD:269870 18/49 (37%)
ATF7-NPFFNP_001353488.1 zf-C2H2 7..31 CDD:306579
C2H2 Zn finger 9..31 CDD:275370
GCN4_cent 47..84 CDD:213399
bZIP_ATF2 334..394 CDD:269835 24/59 (41%)
coiled coil 334..394 CDD:269835 24/59 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.