DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and creb5a

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_009292464.1 Gene:creb5a / 101886947 ZFINID:ZDB-GENE-120827-2 Length:450 Species:Danio rerio


Alignment Length:282 Identity:66/282 - (23%)
Similarity:113/282 - (40%) Gaps:71/282 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNIPASSLLSIDSGGLLMGGHTPKTPEILNSLIAMTNPLENFSYSSA-------AAAAAAVSVAS 61
            ||:...|.:|::|                 |:|.:..|..:.|.||.       |.:..|||..|
Zfish   166 SNMNMESQMSMNS-----------------SIIGIPGPAHSGSCSSVQRSKVIPAHSQPAVSNGS 213

  Fly    62 SSASCSAASTPVVTVRHFNGHPNGQSHSQDSSHSSCSGSPLDSPAGTATTPSVQQTCSRLIKEGL 126
            .:..|.       .:......|:..||.|.:||...               |.||.|..      
Zfish   214 QNPLCH-------MMEMMPSQPHPLSHLQSASHHHA---------------SYQQHCHS------ 250

  Fly   127 KLSIQSKRKLSTCDSSSGSEQPHSKYSRRSSNHNGHSGSSNNYSGSMS--------NANDLDDDC 183
                ||.::|:  ......:|.|..::..|:..:...|.|:..:..:|        ::......|
Zfish   251 ----QSPQRLA--HQHQSQDQSHHSHAHHSTPSHLPLGPSHQNAPPLSHQPIPIQMSSTPKQSHC 309

  Fly   184 EESSDDDSETKSQPKGLTPED--EDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVE 246
            .:|....:..:   :..|.||  ::|||:..|||:.|||:||.|::....:|.:::|.|...|::
Zfish   310 PQSPPQPATGR---RRRTAEDDPDERRRKFLERNRAAATRCRQKRKVWVSSLERKAEELTHTNLQ 371

  Fly   247 LKNQVRQLETERQKLVDMLKSH 268
            |:|:|..|.||..:|..:|.:|
Zfish   372 LQNEVTSLRTEVTQLKQILLTH 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 19/52 (37%)
coiled coil 215..265 CDD:269870 18/49 (37%)
creb5aXP_009292464.1 bZIP_ATF2 332..391 CDD:269835 23/58 (40%)
coiled coil 332..391 CDD:269835 23/58 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.