DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and atf3

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_002934744.1 Gene:atf3 / 100494437 XenbaseID:XB-GENE-6085251 Length:181 Species:Xenopus tropicalis


Alignment Length:197 Identity:61/197 - (30%)
Similarity:88/197 - (44%) Gaps:62/197 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 HPNGQSHSQDSSHSSCSGSPLDSPAGTATTPSVQQTCS----------RLIKEGLKLSIQSKRKL 136
            || ||..:.:.|             .||..|.:..|.|          .|:||.|:.:||:||  
 Frog     5 HP-GQGSAAEVS-------------ATAIVPCLSPTMSFSFEDFTNLTPLVKEELRFAIQNKR-- 53

  Fly   137 STCDSSSGSEQPHSKYSRRSSNHNGHSGSSNNYSGSMSNANDLDDDCEESSDDDSETKSQPKGLT 201
                           :|.|:                     ....|....||...|..:......
 Frog    54 ---------------FSTRA---------------------PCSLDSVVVSDVPMEISAHKTEFV 82

  Fly   202 PEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDMLK 266
            ||::||::|||||||:||.|||.||:|:|::|.||||.|::.|.:||.|:.:|:.|:|.|:.||.
 Frog    83 PEEDDRKKRRRERNKVAAAKCRNKKKEKTESLQKESEKLESINADLKAQIEELKNEKQHLIYMLN 147

  Fly   267 SH 268
            .|
 Frog   148 LH 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 27/52 (52%)
coiled coil 215..265 CDD:269870 25/49 (51%)
atf3XP_002934744.1 bZIP_ATF3 96..149 CDD:269870 27/52 (52%)
coiled coil 96..146 CDD:269870 25/49 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I8943
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003423
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5873
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.