DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and fosb

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_002932681.3 Gene:fosb / 100490871 XenbaseID:XB-GENE-6258697 Length:297 Species:Xenopus tropicalis


Alignment Length:347 Identity:87/347 - (25%)
Similarity:141/347 - (40%) Gaps:73/347 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SSSASCSAASTPVVTVRHFNGHPNGQSHSQDSSHSSCSGSPLDSPAGTATTPSVQQTCSRLIKEG 125
            |||:|.||.|..:.:|..| |.|......|:.: :.|.......|..||.|.|  |....|:...
 Frog     7 SSSSSPSAESQYLSSVDSF-GSPQAAGIPQECA-ALCDAPTSFVPTVTAITSS--QDLQWLVTPA 67

  Fly   126 LKLSIQSKRKLSTCDSSSGSEQPHSKYSRRSSNHNGHSGSSNNYSGSMSNANDLDDDCEESSDDD 190
            |..|:        ..|...|..|...|.....::...||::  |..:::.|....::...|....
 Frog    68 LISSM--------AQSQPTSGPPIDPYDLPGPSYASPSGTT--YGHTLTEAAPEQEEVRPSRARG 122

  Fly   191 SETKSQPKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLE 255
            ..|:.: ..||||:|::||.||||||:||.|||.::||.|..|..|:::|:.:...|:.::.:|.
 Frog   123 KRTREE-AALTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQSETDILEEEKSTLEAEIDELR 186

  Fly   256 TERQKLVDMLKSHGCQRAGGCQLPSQLLQSPAQKYLSELELETVSIDGPNSGNNNQRLQSIPSMA 320
            .::::|...|.||    ..||:||           ..:::|.|.  |...|..:...|.:.|:..
 Frog   187 RQKEQLEFALLSH----RPGCKLP-----------YDDIDLPTT--DPSTSYPHGALLPTYPTQP 234

  Fly   321 TFKY----------------GSKTAAAMAQQLPNGYCKPSPSAQEFEHAGYQQQQQQQQQQQPQS 369
            ...:                ||.|::.:......|.|          .|.||:....::... .|
 Frog   235 EVSFPICLPPLPDSDCATSVGSYTSSFVFTSPEGGAC----------GARYQRSSGSERSSS-DS 288

  Fly   370 LNPAGNNVIDQQHANPSPSLLS 391
            |:              |||||:
 Frog   289 LS--------------SPSLLA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 17/52 (33%)
coiled coil 215..265 CDD:269870 16/49 (33%)
fosbXP_002932681.3 bZIP_Fos 146..199 CDD:269869 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.