DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and atf2

DIOPT Version :9

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_009302699.1 Gene:atf2 / 100006516 ZFINID:ZDB-GENE-030911-8 Length:488 Species:Danio rerio


Alignment Length:380 Identity:87/380 - (22%)
Similarity:140/380 - (36%) Gaps:76/380 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NIPASSLLSIDSGGLLMGGHTPKTPEILNSLIAMTNPLENFSYSSAAAAAAAVSVASSS--ASCS 67
            ::|.|:::            .|.:.::.|.|:|.       |.:......|..|..|||  ....
Zfish   138 SLPPSTIV------------RPPSLQVPNVLLAN-------SEAGVVIQQALPSPTSSSVITHVP 183

  Fly    68 AASTPVVTVRHFNGH-------PNGQSHSQDSSHSSCSGS-------PLDSPA----------GT 108
            ::|.|:|.|   :|.       ||||:.......:..|.|       ||..|.          |.
Zfish   184 SSSRPIVPV---SGTFPVLLQLPNGQTMPVAIPATIASSSVHIPTAIPLVRPVTVVPSVPGIPGP 245

  Fly   109 ATTPSVQQTCSRLIKEGLKLSIQSKRKLSTCD--SSSGSE-----QPHSKYSRRSSNHNGHSGSS 166
            |:...||......:|..|...|.........|  |||.||     .|.::..|..|         
Zfish   246 ASPQPVQSEAKMKLKAALSQQIPQVTNGDAIDIQSSSASETPPPAPPPAEEQRPKS--------- 301

  Fly   167 NNYSGSMSNANDLDDDCEESSDDDSETKSQPKGLTPEDEDRRRRR-RERNKIAATKCRMKKRERT 230
              .....::..::.......:.....|..:.:..|.||.|.:||: .|||:.||::||.|::...
Zfish   302 --LQQPATSTTEIPVSPAPPAQHTPSTGGRRRRTTSEDPDEKRRKFLERNRAAASRCRQKRKVWV 364

  Fly   231 QNLIKESEVLDTQNVELKNQVRQLETERQKLVDMLKSH-GCQRAGGCQLPSQLLQSPAQKYLSEL 294
            |:|.|::|.|.:.|.:|:|:|..|..|..:|..:|.:| .|        |..|||..:.....:.
Zfish   365 QSLEKKAEDLSSVNGQLQNEVTLLRNEVAQLKQLLLAHKDC--------PVTLLQKKSGYQPLDK 421

  Fly   295 ELETVSIDGPNSGNNNQRLQSIPSMATFKYGSKTAAAMAQQLPNGYCKPSPSAQE 349
            |.....:..|:|..|.....|..|.:.....|..|:.:....|.......||.::
Zfish   422 EDSCGEMSVPSSPQNEAIQHSSISTSNGVSSSTAASVLTASSPAAGAAAEPSTED 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 19/52 (37%)
coiled coil 215..265 CDD:269870 18/49 (37%)
atf2XP_009302699.1 C2H2 Zn finger 9..31 CDD:275370
GCN4_cent 47..84 CDD:213399
bZIP_ATF2 341..401 CDD:269835 23/59 (39%)
coiled coil 341..401 CDD:269835 23/59 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.