DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and rplP

DIOPT Version :10

Sequence 1:NP_651954.3 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_417772.1 Gene:rplP / 947806 ECOCYCID:EG10877 Length:136 Species:Escherichia coli


Alignment Length:49 Identity:18/49 - (36%)
Similarity:23/49 - (46%) Gaps:3/49 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 GKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQ-KIYV 167
            |..|||  .|..|...:......|..|:.|||.|||..:...|| ||::
E. coli    19 GLAQGT--DVSFGSFGLKAVGRGRLTARQIEAARRAMTRAVKRQGKIWI 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_651954.3 PTZ00173 1..213 CDD:185498 18/49 (37%)
rplPNP_417772.1 RplP 1..135 CDD:439967 18/49 (37%)

Return to query results.
Submit another query.