DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and Mrpl16

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_079882.2 Gene:Mrpl16 / 94063 MGIID:2137219 Length:251 Species:Mus musculus


Alignment Length:182 Identity:40/182 - (21%)
Similarity:68/182 - (37%) Gaps:31/182 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KSRFCRGVP-DPKIR-----IFDLGRKKATVEDFP---LCVHLVSDEYEQLSSEALEAGRICCNK 74
            |.:|...|| .||:|     :.|:........||.   ..:..:...|  |.....|..|:..|:
Mouse    49 KLKFVERVPLVPKVRREPKNLKDIRGPSTEATDFTEGNFAILALGGGY--LHWGHFEMMRLTINR 111

  Fly    75 YLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVR 139
            ::..   |:.|.|.....||      |.::..|..:...|.:||.   ...|..|:.|  .:.|.
Mouse   112 FMDP---KNMFAIWRVPAPF------KPITRKGVGQRMGGGKGAI---DHYVTPVKTG--CLVVE 162

  Fly   140 SSDRYKAQVIEALRRA---KFKFPGRQKIYVSKKWGFTKYERERYEELRDDN 188
            ...|.:.:.::.:...   |..||.:.   ||:|.....::.:|..||.:.|
Mouse   163 MGGRCEFEEVKGILNQVAHKLPFPAKA---VSRKTLERMHQNQRERELNNQN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 40/182 (22%)
Mrpl16NP_079882.2 Ribosomal_L16_L10e 80..190 CDD:238714 25/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.