DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and SAC52

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_563945.2 Gene:SAC52 / 837993 AraportID:AT1G14320 Length:220 Species:Arabidopsis thaliana


Alignment Length:207 Identity:143/207 - (69%)
Similarity:166/207 - (80%) Gaps:0/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEAL 65
            ||||||||||..|.|||||||:|||||||||||:|:|.|:..|::||.||||||.|.|.:|||||
plant     1 MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEAL 65

  Fly    66 EAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVR 130
            ||.||.||||:||..|||.||:|:|:|||||:||||||||||||||||||||||||..||.|||.
plant    66 EAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKALGTCARVA 130

  Fly   131 IGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGC 195
            |||.::|||..|.:.....||||||||||||||||.||:||||||:.|..:.:||.:.|:.|||.
plant   131 IGQVLLSVRCKDAHGHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRADFTKLRQEKRVVPDGV 195

  Fly   196 NVKYRPEHGPIA 207
            |.|:...|||:|
plant   196 NAKFLSCHGPLA 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 143/207 (69%)
SAC52NP_563945.2 PTZ00173 1..211 CDD:185498 143/207 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 235 1.000 Domainoid score I622
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 305 1.000 Inparanoid score I758
OMA 1 1.010 - - QHG62276
OrthoDB 1 1.010 - - D1215841at2759
OrthoFinder 1 1.000 - - FOG0002057
OrthoInspector 1 1.000 - - otm3190
orthoMCL 1 0.900 - - OOG6_100701
Panther 1 1.100 - - LDO PTHR11726
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1358
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.