DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and AT3G51980

DIOPT Version :10

Sequence 1:NP_651954.3 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_190766.1 Gene:AT3G51980 / 824361 AraportID:AT3G51980 Length:382 Species:Arabidopsis thaliana


Alignment Length:77 Identity:18/77 - (23%)
Similarity:28/77 - (36%) Gaps:18/77 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PYPKSR-FCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKY 79
            |..|.| |.:.|.| .|.:.||..::..:......:.|.|.|.:.|...                
plant   287 PIFKDRLFLKSVVD-LIVVLDLDLQEKALTAIQTLLQLKSIEPQVLKES---------------- 334

  Fly    80 CGKDQFHIRMRL 91
            ||.::...||:|
plant   335 CGLEEALERMKL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_651954.3 PTZ00173 1..213 CDD:185498 18/77 (23%)
AT3G51980NP_190766.1 Fes1 65..156 CDD:462534
armadillo repeat 153..189 CDD:293788
armadillo repeat 195..229 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.