DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and Fes1A

DIOPT Version :10

Sequence 1:NP_651954.3 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_566349.1 Gene:Fes1A / 820091 AraportID:AT3G09350 Length:363 Species:Arabidopsis thaliana


Alignment Length:32 Identity:11/32 - (34%)
Similarity:16/32 - (50%) Gaps:1/32 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DLGRKKATVEDFP-LCVHLVSDEYEQLSSEAL 65
            |..|..||...|| :.:||.|.:..::...||
plant   216 DSDRSIATGLGFPRVMMHLASSDDAEIREAAL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_651954.3 PTZ00173 1..213 CDD:185498 11/32 (34%)
Fes1ANP_566349.1 Fes1 9..95 CDD:462534
SRP1 36..>248 CDD:227396 11/32 (34%)
armadillo repeat 102..126 CDD:293788
armadillo repeat 134..171 CDD:293788
armadillo repeat 177..211 CDD:293788
armadillo repeat 219..250 CDD:293788 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.