| Sequence 1: | NP_651954.3 | Gene: | RpL10 / 43864 | FlyBaseID: | FBgn0024733 | Length: | 218 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_566349.1 | Gene: | Fes1A / 820091 | AraportID: | AT3G09350 | Length: | 363 | Species: | Arabidopsis thaliana |
| Alignment Length: | 32 | Identity: | 11/32 - (34%) |
|---|---|---|---|
| Similarity: | 16/32 - (50%) | Gaps: | 1/32 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 35 DLGRKKATVEDFP-LCVHLVSDEYEQLSSEAL 65 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL10 | NP_651954.3 | PTZ00173 | 1..213 | CDD:185498 | 11/32 (34%) |
| Fes1A | NP_566349.1 | Fes1 | 9..95 | CDD:462534 | |
| SRP1 | 36..>248 | CDD:227396 | 11/32 (34%) | ||
| armadillo repeat | 102..126 | CDD:293788 | |||
| armadillo repeat | 134..171 | CDD:293788 | |||
| armadillo repeat | 177..211 | CDD:293788 | |||
| armadillo repeat | 219..250 | CDD:293788 | 10/29 (34%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||