DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RpL10 and Hspbp1

DIOPT Version :9

Sequence 1:	NP_001262233.1	Gene:	RpL10 / 43864	FlyBaseID:	FBgn0024733	Length:	218	Species:	Drosophila melanogaster
Sequence 2:	NP_001347558.1	Gene:	Hspbp1 / 66245	MGIID:	1913495	Length:	357	Species:	Mus musculus

Alignment Length:	136	Identity:	30/136 - (22%)
Similarity:	56/136 - (41%)	Gaps:	20/136 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    66 EAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQ--GTVAR 128
            |||       |:::...|.|.:.||.....|    :.|....|..||..:   .|.|:  ||:..
Mouse   218 EAG-------LLQFLRLDGFSVLMRAMQQQV----QKLKVKSAFLLQNLL---VGHPEHKGTLCS 268

  Fly   129 VRIGQPIMSVRSSDR--YKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEEL--RDDNR 189
            :.:.|.::::..::.  :...|:.||......||...:.....:.|..:..|.|.:.|  |::.:
Mouse   269 MGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQREEYQ 333

  Fly   190 LEPDGC 195
            .|.:.|
Mouse   334 EELEFC 339

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RpL10	NP_001262233.1	PTZ00173	1..213	CDD:185498	30/136 (22%)
Hspbp1	NP_001347558.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..68
		Fes1	43..137	CDD:369996
		ARM 1	130..172
		armadillo repeat	135..172	CDD:293788
		ARM 2	175..215
		armadillo repeat	178..213	CDD:293788
		ARM 3	218..257		13/52 (25%)
		armadillo repeat	231..255	CDD:293788	7/27 (26%)
		ARM 4	260..299		7/38 (18%)
		armadillo repeat	263..299	CDD:293788	6/35 (17%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0197
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900