DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and SIL1

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_011541872.1 Gene:SIL1 / 64374 HGNCID:24624 Length:471 Species:Homo sapiens


Alignment Length:206 Identity:39/206 - (18%)
Similarity:66/206 - (32%) Gaps:72/206 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEAL 65
            :|...|.|:.:|.:....| .|....|: |....:..||:...|             |:|.:|.|
Human    28 LGLLMAACFTFCLSHQNLK-EFALTNPE-KSSTKETERKETKAE-------------EELDAEVL 77

  Fly    66 EAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVR 130
            |.                       .||.|..:           .||.|.    ..|.|:..|:.
Human    78 EV-----------------------FHPTHEWQ-----------ALQPGQ----AVPAGSHVRLN 104

  Fly   131 I--GQPIMSVRSSDRYK-------------AQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERER 180
            :  |:....::..|:::             ....:.|:.|..||....::..||:....:.|.:|
Human   105 LQTGEREAKLQYEDKFRNNLKGKRLDINTNTYTSQDLKSALAKFKEGAEMESSKEDKARQAEVKR 169

  Fly   181 ----YEELRDD 187
                .|||:.|
Human   170 LFRPIEELKKD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 39/206 (19%)
SIL1XP_011541872.1 Fes1 <203..232 CDD:285773
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.