Sequence 1: | NP_001262233.1 | Gene: | RpL10 / 43864 | FlyBaseID: | FBgn0024733 | Length: | 218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011541872.1 | Gene: | SIL1 / 64374 | HGNCID: | 24624 | Length: | 471 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 39/206 - (18%) |
---|---|---|---|
Similarity: | 66/206 - (32%) | Gaps: | 72/206 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEAL 65
Fly 66 EAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVR 130
Fly 131 I--GQPIMSVRSSDRYK-------------AQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERER 180
Fly 181 ----YEELRDD 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RpL10 | NP_001262233.1 | PTZ00173 | 1..213 | CDD:185498 | 39/206 (19%) |
SIL1 | XP_011541872.1 | Fes1 | <203..232 | CDD:285773 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0197 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |