DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and RPL10

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001243506.2 Gene:RPL10 / 6134 HGNCID:10298 Length:216 Species:Homo sapiens


Alignment Length:146 Identity:106/146 - (72%)
Similarity:116/146 - (79%) Gaps:7/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEAL 65
            ||||||||||||||||||||||||||||.||||||||||||.|::||||.|:|||||||||||||
Human     1 MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEAL 65

  Fly    66 EAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVR 130
            ||.|||.|||:||.||||.||||:|||||||||||||||||||||..:...||  .|...:..::
Human    66 EAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRSTSQRSGA--SPSSMLMNLK 128

  Fly   131 I-----GQPIMSVRSS 141
            .     |...|:|.||
Human   129 TWWLKSGSSQMAVGSS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 106/146 (73%)
RPL10NP_001243506.2 Ribosomal_L16_L10e 1..>110 CDD:294252 96/108 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159321
Domainoid 1 1.000 273 1.000 Domainoid score I1795
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 353 1.000 Inparanoid score I2260
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62276
OrthoDB 1 1.010 - - D1215841at2759
OrthoFinder 1 1.000 - - FOG0002057
OrthoInspector 1 1.000 - - otm41637
orthoMCL 1 0.900 - - OOG6_100701
Panther 1 1.100 - - LDO PTHR11726
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1106
SonicParanoid 1 1.000 - - X1358
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.