DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and RGD1564963

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_006242351.1 Gene:RGD1564963 / 503169 RGDID:1564963 Length:100 Species:Rattus norvegicus


Alignment Length:95 Identity:63/95 - (66%)
Similarity:75/95 - (78%) Gaps:0/95 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 MRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERE 179
            |||||||||||||||.|||.|||:|:..:.|..||||||||||||||||||::||||||||:..:
  Rat     1 MRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNAD 65

  Fly   180 RYEELRDDNRLEPDGCNVKYRPEHGPIAAW 209
            .:|::..:.||.||||.|||.|..||:..|
  Rat    66 EFEDMVAEKRLIPDGCGVKYIPNRGPLDKW 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 63/95 (66%)
RGD1564963XP_006242351.1 Ribosomal_L16_L10e <1..95 CDD:412329 62/93 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1215841at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.