DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and RGD1563861

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_574109.1 Gene:RGD1563861 / 498828 RGDID:1563861 Length:214 Species:Rattus norvegicus


Alignment Length:209 Identity:156/209 - (74%)
Similarity:177/209 - (84%) Gaps:0/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEAL 65
            ||||||||||||||||||||||||||||.||||||||||||.|::||||.|:||||||||||||:
  Rat     1 MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEAM 65

  Fly    66 EAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVR 130
            ||.|||.|||:||.||||.|||::||.||||:||||||||.|||||||||.|||||||||||||.
  Rat    66 EAARICANKYMVKSCGKDGFHIQVRLRPFHVMRINKMLSCVGADRLQTGMCGAFGKPQGTVARVH 130

  Fly   131 IGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGC 195
            :||.|||:|:..:.|..||||||||||||||||||::.|||.|||:..:.:|::..:.||.||||
  Rat   131 LGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHIPKKWDFTKFNADEFEDMVAEKRLIPDGC 195

  Fly   196 NVKYRPEHGPIAAW 209
            .|||.|..||:..|
  Rat   196 GVKYIPNRGPLDKW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 156/209 (75%)
RGD1563861XP_574109.1 PTZ00173 1..209 CDD:185498 155/207 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H133863
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1215841at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.