DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and rpl10

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001004965.1 Gene:rpl10 / 448389 XenbaseID:XB-GENE-970510 Length:215 Species:Xenopus tropicalis


Alignment Length:218 Identity:169/218 - (77%)
Similarity:186/218 - (85%) Gaps:4/218 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEAL 65
            |||||||||||||||||||||||||||||||||||||||||.|::||||.|:|||||||||||||
 Frog     1 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEAL 65

  Fly    66 EAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVR 130
            ||.|||.|||:||.||||.||||:||||||||||||||||||||||||||||||||||||||||.
 Frog    66 EAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVH 130

  Fly   131 IGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGC 195
            |||.|||:|:..:.|..||||||||||||||||||::||||||||:..:.:|.|..:.||.||||
 Frog   131 IGQVIMSIRTKTQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFESLLAEKRLIPDGC 195

  Fly   196 NVKYRPEHGPIAAWEKAQRDVYA 218
            .|||.|..||:..|    |.::|
 Frog   196 GVKYIPNRGPLDKW----RAIHA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 167/211 (79%)
rpl10NP_001004965.1 PTZ00173 1..209 CDD:185498 166/207 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 277 1.000 Domainoid score I1703
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H133863
Inparanoid 1 1.050 358 1.000 Inparanoid score I2172
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1215841at2759
OrthoFinder 1 1.000 - - FOG0002057
OrthoInspector 1 1.000 - - oto104334
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1106
SonicParanoid 1 1.000 - - X1358
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.