DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and Sil1

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster


Alignment Length:153 Identity:32/153 - (20%)
Similarity:57/153 - (37%) Gaps:61/153 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LVSDEYEQLS-SEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGM 115
            :.:||::.:: .:|:..|                      ||    :|||          ||||:
  Fly    35 VATDEWQTIAEGQAIPRG----------------------LH----VRIN----------LQTGL 63

  Fly   116 RGA---FGKPQGTVARVRIGQP-IMSVRSSD--------RYKAQVI-EALRRAKFKFPGRQKIYV 167
            :.|   ....:||..:   .|| ..:.|.|.        .||..:| |::||.|    .::|.|.
  Fly    64 KEAKLLDESERGTSLQ---SQPDDQNARESHDDNEPLALDYKPDIIEESIRRVK----EQKKSYA 121

  Fly   168 SKKWGFTKYERERYEELRDDNRL 190
            ..:..:.::::    ..|.|..|
  Fly   122 ELRKAYKEFQK----NFRTDGEL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 32/153 (21%)
Sil1NP_651356.1 SIL1 167..>326 CDD:374797
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.