DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and CG10973

DIOPT Version :10

Sequence 1:NP_651954.3 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001034002.1 Gene:CG10973 / 39447 FlyBaseID:FBgn0036306 Length:306 Species:Drosophila melanogaster


Alignment Length:102 Identity:16/102 - (15%)
Similarity:37/102 - (36%) Gaps:18/102 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DPKIRIFDLGRKKATVEDFPLCVH-LVSDEYEQLSSEAL---EAGRICCNKYLVKYC------GK 82
            |.::|...|.......::...|.: |::|::....::.|   ....:.|:.|.:...      |.
  Fly   114 DSEVRESALNTVAEVAQNNVFCQNALINDKFLPALAKNLSHSNPNTVRCSLYAISSLIRNFQPGY 178

  Fly    83 DQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAF 119
            |:|.        .:..|..::.|..:......::.||
  Fly   179 DEFK--------RIKGIRSLIPCLKSTNTNVYVKTAF 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_651954.3 PTZ00173 1..213 CDD:185498 16/102 (16%)
CG10973NP_001034002.1 Fes1 13..94 CDD:462534
armadillo repeat 97..128 CDD:293788 3/13 (23%)
armadillo repeat 136..172 CDD:293788 5/35 (14%)
armadillo repeat 178..209 CDD:293788 6/38 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.