DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and CG10973

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001034002.1 Gene:CG10973 / 39447 FlyBaseID:FBgn0036306 Length:306 Species:Drosophila melanogaster


Alignment Length:102 Identity:16/102 - (15%)
Similarity:37/102 - (36%) Gaps:18/102 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DPKIRIFDLGRKKATVEDFPLCVH-LVSDEYEQLSSEAL---EAGRICCNKYLVKYC------GK 82
            |.::|...|.......::...|.: |::|::....::.|   ....:.|:.|.:...      |.
  Fly   114 DSEVRESALNTVAEVAQNNVFCQNALINDKFLPALAKNLSHSNPNTVRCSLYAISSLIRNFQPGY 178

  Fly    83 DQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAF 119
            |:|.        .:..|..::.|..:......::.||
  Fly   179 DEFK--------RIKGIRSLIPCLKSTNTNVYVKTAF 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 16/102 (16%)
CG10973NP_001034002.1 Fes1 13..94 CDD:285773
ARM <92..172 CDD:237987 9/57 (16%)
armadillo repeat 97..128 CDD:293788 3/13 (23%)
HEAT_2 <104..171 CDD:290374 9/56 (16%)
armadillo repeat 136..172 CDD:293788 5/35 (14%)
ARM 138..258 CDD:237987 12/78 (15%)
armadillo repeat 178..209 CDD:293788 6/38 (16%)
HEAT repeat 227..257 CDD:293787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.