DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and Rpl10l

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_003750221.1 Gene:Rpl10l / 299106 RGDID:1305913 Length:214 Species:Rattus norvegicus


Alignment Length:209 Identity:166/209 - (79%)
Similarity:181/209 - (86%) Gaps:0/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEAL 65
            ||||||||||||||||||||||||||||.||||||||||||.|::||||.|:|||||||||||||
  Rat     1 MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEAL 65

  Fly    66 EAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVR 130
            ||.|||.|||:||.||||.||||:||||||||||||||||||||||||||||||||||||||||.
  Rat    66 EAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVH 130

  Fly   131 IGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGC 195
            |||.|||:|:..:.|..||||||||||||||||||::||||||||:..:.:|:.....||.||||
  Rat   131 IGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDKVAAKRLIPDGC 195

  Fly   196 NVKYRPEHGPIAAW 209
            .|||.||.||:..|
  Rat   196 GVKYIPERGPLDKW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 166/209 (79%)
Rpl10lXP_003750221.1 PTZ00173 1..209 CDD:185498 165/207 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353347
Domainoid 1 1.000 273 1.000 Domainoid score I1719
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 353 1.000 Inparanoid score I2184
OMA 1 1.010 - - QHG62276
OrthoDB 1 1.010 - - D1215841at2759
OrthoFinder 1 1.000 - - FOG0002057
OrthoInspector 1 1.000 - - otm45760
orthoMCL 1 0.900 - - OOG6_100701
Panther 1 1.100 - - O PTHR11726
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1358
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.